PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00058.48
Common NameAMTR_s00058p00090300, LOC18434720
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family WRKY
Protein Properties Length: 522aa    MW: 55874.7 Da    PI: 8.6364
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00058.48genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.21.5e-32226282259
                                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                              dDgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkver+  +++v+ei+Y+g+Hnh 
  evm_27.model.AmTr_v1.0_scaffold00058.48 226 DDGYNWRKYGQKQVKGSEYPRSYYKCTHPSCPVKKKVERNL-EGHVTEIIYKGQHNHA 282
                                              8****************************************.***************7 PP

2WRKY1031.7e-32408466159
                                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                              ldDgy+WrKYGqK+vkg+++prsYY+Ct  gC+v+k+ver+++d + v++tYeg+Hnh+
  evm_27.model.AmTr_v1.0_scaffold00058.48 408 LDDGYRWRKYGQKVVKGNPHPRSYYKCTNVGCNVRKHVERASNDARSVITTYEGKHNHD 466
                                              59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.5E-28220284IPR003657WRKY domain
SuperFamilySSF1182901.96E-25223284IPR003657WRKY domain
SMARTSM007741.8E-35225283IPR003657WRKY domain
PfamPF031061.0E-24226281IPR003657WRKY domain
PROSITE profilePS5081123.388226284IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-36393468IPR003657WRKY domain
SuperFamilySSF1182905.1E-29400468IPR003657WRKY domain
PROSITE profilePS5081138.021403468IPR003657WRKY domain
SMARTSM007742.9E-38408467IPR003657WRKY domain
PfamPF031062.5E-25409466IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MAGKEAGASK EPPPRPTITL PGRSSVENFF KGGSDISPGP MTLVTSFFSE NDAETECRSF  60
SQLLAGAMAS PNAFHGRNPA FSSGNSGFSG ENSGQDSVTV KQSRPLSLVV SPPSFLTIPP  120
GLSPTGLLDS PVFISSAQGQ FGISHQQALA QVTAQAAQSQ SQLHFQAEYP PSISAPSLTH  180
SAPPPPVNAT PIQQRMPSAS DGKESGEVSY SERRSHAPIV VDKPSDDGYN WRKYGQKQVK  240
GSEYPRSYYK CTHPSCPVKK KVERNLEGHV TEIIYKGQHN HAMPQTNKRV KDGGSLVGGT  300
SEGNGSSDAI AKSETGGYSG SLSSVNAPGP SMQRRDQEYG QGTPDNMSGS SDGEEAGGAI  360
VKADDRHDDE PDLKRRNIAD RETQVSTSHR TVTEPRIIVQ TTSEVDLLDD GYRWRKYGQK  420
VVKGNPHPRS YYKCTNVGCN VRKHVERASN DARSVITTYE GKHNHDVPAA KNSSHNTMPM  480
ATGKISSTPL DKQATTLQST GVSRPKEEPF SGLLTQNPGP K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-38226469878Probable WRKY transcription factor 4
2lex_A3e-38226469878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011623586.10.0PREDICTED: probable WRKY transcription factor 3
RefseqXP_006844846.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9XI901e-150WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLW1PFV60.0W1PFV6_AMBTC; Uncharacterized protein
STRINGVIT_14s0108g01280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-125WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]